Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G230600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000534 |
| Alias | Chr05:61321204|61321868 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 61321204-61321868 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G230600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.005G230600.5:4 Gorai.005G230600.2:4 Gorai.005G230600.1:4 Gorai.005G230600.4:4 Gorai.005G230600.3:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000046* |
| PMCS | 0.135588133 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
61321442-61321224(+) |
| Potential amino acid sequence |
MATPSQPTPRLCTEGGIGVALAYLDAAINVPVDSMIAAKEAAMTETASPAWKLGLPHCNGYGTL IRIQKGKA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |