Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G60600_circ_g.7 |
| ID in PlantcircBase | ath_circ_045033 |
| Alias | At_ciR2889 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 24360769-24360999 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ, CIRI-full |
| Parent gene | AT5G60600 |
| Parent gene annotation |
4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin ), chloroplastic |
| Parent gene strand | + |
| Alternative splicing | AT5G60600_circ_g.8 AT5G60600_circ_g.9 AT5G60600_circ_g.10 |
| Support reads | 3/1 |
| Tissues | leaf/aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G60600.4:1 AT5G60600.5:1 AT5G60600.3:1 AT5G60600.2:1 AT5G60600.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.469535112 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24360835-24360996(+) |
| Potential amino acid sequence |
MKASNPVIMVQAYRLLVAEMYVHGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLQVESAFEFAR ICRKLDYHNFVFSMKASNPVIMVQAYRLLVAEMYVHGWDYPLHLGVTEAGEGEDGRMKSAIGIG TLLQVESAFEFARICRKLDYHNFVFSMKASNPVIMVQAYRLLVAEMYVHGWDYPLHLGVTEAGE GEDGRMKSAIGIGTLLQVESAFEFARICRKLDYHNFVFSMKASNPVIMVQAYRLLVAEMYVHGW DYPLHLGVTEAGEGEDGRMKSAIGIGTLLQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |