Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0390500_circ_g.1 |
| ID in PlantcircBase | osa_circ_023625 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 19222030-19222438 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0390500 |
| Parent gene annotation |
Similar to OSIGBa0132D06.2 protein. (Os04t0390500-01);Mn-nicotia namine transporter, Detoxification of excess manganese (Os04t039 0500-02);Iron-phytosiderophore transporter protein yellow stripe 1. (Os04t0390500-03);Similar to OSIGBa0132D06.2 protein. (Os04t 0390500-04) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0390500-01:2 Os04t0390500-03:2 Os04t0390500-04:2 Os04t0390500-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.232849083 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19222048-19222099(+) 19222073-19222369(-) |
| Potential amino acid sequence |
MLAMDQKTYELIGPDYPGNRAIDVMNPSLGWMIGFMFVVSFLGLFSLVALRKVMVIDYKLTYPS GTATAMLINSFHTTSGAELAEGFWVIYACNGSENIRTYWARLSW*(+) MFSDPLQAYMTQNPSASSAPLVVWKLFINIAVAVPLG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |