Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0369800_circ_g.2 |
| ID in PlantcircBase | osa_circ_019985 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 14514967-14516223 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0369800 |
| Parent gene annotation |
Similar to Novel plant SNARE 13 (AtNPSN13). (Os03t0369800-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0369800_circ_g.1 Os03g0369800_circ_g.3 Os03g0369800_circ_g.4 Os03g0369800_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0369800-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.134171765 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14516124-14515125(+) 14516176-14516214(-) |
| Potential amino acid sequence |
MLFGCCPRQQVHYFQRPYQRAQPSYYYYLGYFDILTTIIAITPQTIRKSNAIMHLSVAT*(+) MGAGSSEPAAEDNIQIASAMTNQQLMDAGREQMTQTDQAIDRSKMVVAQTIETGTQTASALSQQ TEQMKRIGNELDTVHFSLKKASQLVKEIGRQVATDKCIMALLFLIVCGVIAIIVVKISK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |