Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0659900_circ_g.1 |
| ID in PlantcircBase | osa_circ_025786 |
| Alias | Os_ciR3039 |
| Organism | Oryza sativa |
| Position | chr4: 33666139-33666904 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0659900 |
| Parent gene annotation |
Similar to OSIGBa0132E09-OSIGBa0108L24.21 protein. (Os04t0659900 -01);Similar to OSIGBa0132E09-OSIGBa0108L24.21 protein. (Os04t06 59900-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0659900-01:2 Os04t0659900-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.113149891 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33666156-33666171(+) 33666163-33666861(-) |
| Potential amino acid sequence |
MASGGRDAERVRLKLEIVVESVDYDKEGSVLRVRGKNITENDHVKIGQFHTVELELKRQFTLTK ESSERDGIWRT*(+) MPSLSELSFVKVNCLFSSSSTV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |