Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0639550_circ_g.1 |
ID in PlantcircBase | osa_circ_015743 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 25655015-25655144 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0639550 |
Parent gene annotation |
Hypothetical protein. (Os02t0639550-00) |
Parent gene strand | - |
Alternative splicing | Os02g0639500_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0639500-01:1 Os02t0639550-00:1 Os02t0639500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.427185256 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25655131-25655055(+) 25655133-25655138(-) |
Potential amino acid sequence |
MQLKQDGVQVRGEEHCLPRERGLDDLLALASRRIRGWRRRHWIHAAKTGRRASTGGRTLPST*( +) MDPMSPSPSSNSTRSESQKVVEPSFTWKAMFFPPYLHAVLF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |