Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0639550_circ_g.1 |
| ID in PlantcircBase | osa_circ_015743 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 25655015-25655144 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0639550 |
| Parent gene annotation |
Hypothetical protein. (Os02t0639550-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0639500_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0639500-01:1 Os02t0639550-00:1 Os02t0639500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.427185256 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25655131-25655055(+) 25655133-25655138(-) |
| Potential amino acid sequence |
MQLKQDGVQVRGEEHCLPRERGLDDLLALASRRIRGWRRRHWIHAAKTGRRASTGGRTLPST*( +) MDPMSPSPSSNSTRSESQKVVEPSFTWKAMFFPPYLHAVLF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |