Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G71220_circ_g.11 |
| ID in PlantcircBase | ath_circ_009589 |
| Alias | At_ciR2399 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 26845424-26845800 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT1G71220 |
| Parent gene annotation |
UDP-glucose:glycoprotein glucosyltransferases;transferases, tran sferring hexosyl groups;transferases, transferring glycosyl grou ps |
| Parent gene strand | + |
| Alternative splicing | AT1G71220_circ_g.10 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G71220.3:2 AT1G71220.1:2 AT1G71220.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.300613641 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26845723-26845797(+) |
| Potential amino acid sequence |
MFVFKLGLAKLKCSFLMNGLVFDSVELNTLRTESADSSEADIEQEHVDGAFVETILPKVKTLPQ DILLKLRQEHTLKEASEASSMFVFKLGLAKLKCSFLMNGLVFDSVELNTLRTESADSSEADIEQ EHVDGAFVETILPKVKTLPQDILLKLRQEHTLKEASEASSMFVFKLGLAKLKCSFLMNGLVFDS VELNTLRTESADSSEADIEQEHVDGAFVETILPKVKTLPQDILLKLRQEHTLKEASEASSMFVF KLGLAKLKCSFLMNGLVFDSVE(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |