Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014188_circ_g.4 |
ID in PlantcircBase | zma_circ_008445 |
Alias | zma_circ_0002071 |
Organism | Zea mays |
Position | chr5: 35620885-35621421 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d014188 |
Parent gene annotation |
Phospholipid-transporting ATPase 3 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d014188_T030:3 Zm00001d014188_T010:3 Zm00001d014188_T015:3 Zm00001d014188_T033:3 Zm00001d014188_T027:3 Zm00001d014188_T014:3 Zm00001d014188_T026:3 Zm00001d014188_T007:3 Zm00001d014188_T012:3 Zm00001d014188_T021:3 Zm00001d014188_T019:3 Zm00001d014188_T005:3 Zm00001d014188_T031:3 Zm00001d014188_T002:3 Zm00001d014188_T034:2 Zm00001d014188_T001:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.256716217 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35620905-35620911(+) 35621364-35620911(+) |
Potential amino acid sequence |
MVRESHVERMGSIQDVPYEILNVLEFNSTRKRQSVVCRFPNGRLVLYCKGADNVVYERLADGNH DMKKTSREHLEQFGSAGLRTLCLAYRDLSREQYESWNEKFVQAKSSLRDRDKKLDEAYTHHSYG S*(+) MKSLYKQSHLYEIVIRSSMRRTPTTVMVRESHVERMGSIQDVPYEILNVLEFNSTRKRQSVVCR FPNGRLVLYCKGADNVVYERLADGNHDMKKTSREHLEQFGSAGLRTLCLAYRDLSREQYESWNE KFVQAKSSLRDRDKKLDEAYTHHSYGS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |