Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0358700_circ_g.2 |
| ID in PlantcircBase | osa_circ_027585 |
| Alias | Os05circ08540 |
| Organism | Oryza sativa |
| Position | chr5: 17053062-17053193 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os05g0358700 |
| Parent gene annotation |
Similar to predicted protein. (Os05t0358700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0358700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.245576515 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17053153-17053064(-) |
| Potential amino acid sequence |
MNGKPWEAGKFSLSLRLSLWAEHLGLHRGEIAVVIEDKEVVSSKMNGKPWEAGKFSLSLRLSLW AEHLGLHRGEIAVVIEDKEVVSSKMNGKPWEAGKFSLSLRLSLWAEHLGLHRGEIAVVIEDKEV VSSKMNGKPWEAGKFSLSLRLSLWAEHLGLHRGE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |