Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa1G048950_circ_g.2 |
| ID in PlantcircBase | csa_circ_000190 |
| Alias | Chr1:5604117_5604829 |
| Organism | Cucumis sativus |
| Position | chrChr1: 5604117-5604829 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | ue-circRNA |
| Identification method | Find_circ |
| Parent gene | Csa1G048950 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | Csa1G048950_circ_g.1 Csa1G048950_circ_g.3 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Csa1G048950.1:2 Csa1G048950.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.676075327 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5604672-5604822(-) 5604137-5604746(-) |
| Potential amino acid sequence |
MFALGENLTSRYKIHSKMGEGTFGQVLECWDREKKEMVAIKIVRGIRKYRDAAMIEIEVLQQLG KHDKGGNRLR* MIKVATGSGRNMLWTRDCEYSKLCIYKSTIRSFF* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to salt stress in root |
| Other Information | |
|---|---|
| References | He et al., 2020 |