Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d003937_circ_g.1 |
ID in PlantcircBase | zma_circ_007199 |
Alias | zma_circ_0001085 |
Organism | Zea mays |
Position | chr2: 70458565-70458887 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d003937 |
Parent gene annotation |
RecQ-mediated genome instability protein 1 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d003937_T003:2 Zm00001d003937_T001:2 Zm00001d003937_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.070175181 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
70458769-70458884(+) |
Potential amino acid sequence |
MLGLSPGEVTAALAGELEFASPSEVKETLKGFQKFLVKFEGLITSVKKFQYKQRTKYELYVYID DGSFISEAFIDSDIVNNMLGLSPGEVTAALAGELEFASPSEVKETLKGFQKFLVKFEGLITSVK KFQYKQRTKYELYVYIDDGSFISEAFIDSDIVNNMLGLSPGEVTAALAGELEFASPSEVKETLK GFQKFLVKFEGLITSVKKFQYKQRTKYELYVYIDDGSFISEAFIDSDIVNNMLGLSPGEVTAAL AGELEFASPSEVKETLKGFQKFLVKFE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |