Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G07120_circ_g.1 |
| ID in PlantcircBase | ath_circ_036836 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 2207476-2207562 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT5G07120 |
| Parent gene annotation |
Sorting nexin 2B |
| Parent gene strand | - |
| Alternative splicing | AT5G07120_circ_g.2 |
| Support reads | 2 |
| Tissues | leaf, aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G07120.2:1 AT5G07120.3:1 AT5G07120.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104406133 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2207503-2207478(-) |
| Potential amino acid sequence |
MMKGFVANQENNWSEVERLDRERRADFLNMMKGFVANQENNWSEVERLDRERRADFLNMMKGFV ANQENNWSEVERLDRERRADFLNMMKGFVANQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |