Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0595500_circ_g.1 |
| ID in PlantcircBase | osa_circ_029244 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 29665606-29666514 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0595500 |
| Parent gene annotation |
Pleckstrin homology-type domain containing protein. (Os05t059550 0-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0595500-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006444* |
| PMCS | 0.360241832 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29666430-29665687(+) 29666482-29666458(-) 29665688-29666487(-) |
| Potential amino acid sequence |
MVRSAGGRPLSFHKHHPSNYVTSIRKSIVCRFKIIVYTLPLQNNKPRKPIIDISII*(+) MDDVYGRIEVFPQHFLPSQQSMETPADGLSTSKTNLDSPPSSRRRSWTPKRVMGAASLLHLLSL PRIRWSSSTEDDDKIELTRAEVESLRTEIADAEERESQLKARLENIDEVLRYARLSGYLYIRSR WTQLPGEPPILDDADVDDWLPRFVVLQGQCVYYYLKSTDYALSNRGNIVGWMMFMEG*(-) MMLMSMIGFLGLLFCKGNVYTIILNLQTMLFLIEVT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |