Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0595500_circ_g.1 |
ID in PlantcircBase | osa_circ_029244 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 29665606-29666514 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0595500 |
Parent gene annotation |
Pleckstrin homology-type domain containing protein. (Os05t059550 0-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0595500-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006444* |
PMCS | 0.360241832 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29666430-29665687(+) 29666482-29666458(-) 29665688-29666487(-) |
Potential amino acid sequence |
MVRSAGGRPLSFHKHHPSNYVTSIRKSIVCRFKIIVYTLPLQNNKPRKPIIDISII*(+) MDDVYGRIEVFPQHFLPSQQSMETPADGLSTSKTNLDSPPSSRRRSWTPKRVMGAASLLHLLSL PRIRWSSSTEDDDKIELTRAEVESLRTEIADAEERESQLKARLENIDEVLRYARLSGYLYIRSR WTQLPGEPPILDDADVDDWLPRFVVLQGQCVYYYLKSTDYALSNRGNIVGWMMFMEG*(-) MMLMSMIGFLGLLFCKGNVYTIILNLQTMLFLIEVT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |