Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G263200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000680 |
| Alias | Chr06:50282251|50282985 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 50282251-50282985 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | u-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G263200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G263200.5:3 Gorai.006G263200.3:3 Gorai.006G263200.2:4 Gorai.006G263200.1:4 Gorai.006G263200.6:4 Gorai.006G263200.4:3 Gorai.006G263200.7:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000358* |
| PMCS | 0.120241905 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
50282285-50282274(+) |
| Potential amino acid sequence |
MRNVGFGHLEPGKGYHFPDGPFVEYKGTVPLNELQNKQREIEIEVNALISKGGKVNATVLPYRE AAELCGGSLPDYIHPGSNPRIIKLGDNPGCPCGGTHVSDVSEILSMKAALSWAFA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |