Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA017594_circ_g.2 |
| ID in PlantcircBase | osi_circ_006380 |
| Alias | 5:28924782|28925874 |
| Organism | Oryza sativa ssp. indica |
| Position | chr5: 28924782-28925874 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA017594 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA017594_circ_g.1 BGIOSGA017594_circ_g.3 BGIOSGA017594_circ_g.4 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA017594-TA:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28925668-28925668(-) 28925027-28925821(-) 28925862-28924833(+) |
| Potential amino acid sequence |
MDKGTDAVDILEGRSYRLQQQWIGVVNRSQQDINKNVDMIAARRREREYFSTTPEYKHLAHRMG SEHLAKSLSKHLETVIKSRIPGLQSLITKTIAELETELNRLGKPIATDAGGKLYTIMEICRMFD GIYKEHLDGVPIVSFWLFLQPIRILQLLMQLRFHGKLTPKVKGRLVCLQKLI*(-) MLEESCTRSWKYAACLMVSTKNIWMESQLYHSGCFSSQSGSCNF*(-) MIQLGLHPDVLCRYHQTCGIFP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |