Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0608800_circ_g.2 |
ID in PlantcircBase | osa_circ_031332 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 24231425-24233689 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0608800 |
Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os06 t0608800-01);Zinc finger, RING/FYVE/PHD-type domain containing p rotein. (Os06t0608800-02);Similar to Copine-1. (Os06t0608800-03) ;Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os0 6t0608800-04) |
Parent gene strand | - |
Alternative splicing | Os06g0608500_circ_igg.1 Os06g0608600_circ_g.1 Os06g0608600_circ_g.2 Os06g0608700_circ_g.1 Os06g0608700_circ_g.2 Os06g0608700_circ_g.3 Os06g0608700_circ_g.4 Os06g0608800_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0608800-02:5 Os06t0608800-01:5 Os06t0608800-04:5 Os06t0608800-03:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.147468591 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24233561-24231753(+) 24233670-24233674(-) |
Potential amino acid sequence |
MHLQGMQGISSYIPMMNSHDHMKKNSCMRAWSPLPPFLTSVEFPVHRLLSEEHDTDHQCCLQYQ LLFQSSGQKMLVQLIEESEQFLCIFLMPLQIRCMGGSLDKS*(+) MGAKDSKPSYSYSSSYDHGNSSSGYNSRYPAYPANASSSQNTRYAPSMENYVQPETHARLQRKY SRIGDDYRSLNQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFNRRCLHDIGNTPNPYEQAI SIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPENRPCNGFEEALERYREIVPTLRLAGPT SFAPMIETAIGIVDSTGGQYHVLLIIADGQGIQLR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |