Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0608800_circ_g.2 |
| ID in PlantcircBase | osa_circ_031332 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 24231425-24233689 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0608800 |
| Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os06 t0608800-01);Zinc finger, RING/FYVE/PHD-type domain containing p rotein. (Os06t0608800-02);Similar to Copine-1. (Os06t0608800-03) ;Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os0 6t0608800-04) |
| Parent gene strand | - |
| Alternative splicing | Os06g0608500_circ_igg.1 Os06g0608600_circ_g.1 Os06g0608600_circ_g.2 Os06g0608700_circ_g.1 Os06g0608700_circ_g.2 Os06g0608700_circ_g.3 Os06g0608700_circ_g.4 Os06g0608800_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0608800-02:5 Os06t0608800-01:5 Os06t0608800-04:5 Os06t0608800-03:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.147468591 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24233561-24231753(+) 24233670-24233674(-) |
| Potential amino acid sequence |
MHLQGMQGISSYIPMMNSHDHMKKNSCMRAWSPLPPFLTSVEFPVHRLLSEEHDTDHQCCLQYQ LLFQSSGQKMLVQLIEESEQFLCIFLMPLQIRCMGGSLDKS*(+) MGAKDSKPSYSYSSSYDHGNSSSGYNSRYPAYPANASSSQNTRYAPSMENYVQPETHARLQRKY SRIGDDYRSLNQVTEALAQAGLESSNLIVGIDFTKSNEWTGKLSFNRRCLHDIGNTPNPYEQAI SIIGRTLSAFDEDNLIPCFGFGDASTHDQEVFSFYPENRPCNGFEEALERYREIVPTLRLAGPT SFAPMIETAIGIVDSTGGQYHVLLIIADGQGIQLR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |