Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G47910_circ_g.2 |
| ID in PlantcircBase | ath_circ_042988 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 19399055-19399168 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | AT5G47910 |
| Parent gene annotation |
Respiratory burst oxidase homolog protein D |
| Parent gene strand | + |
| Alternative splicing | AT5G47910_circ_g.1 AT5G47910_circ_g.3 AT5G47910_circ_g.4 |
| Support reads | 3 |
| Tissues | siliques and seeds |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G47910.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.263883045 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19399130-19399165(+) |
| Potential amino acid sequence |
MEELDPDNAGFIMIISLSASANKLSNIQKQAKEYAALIMEELDPDNAGFIMIISLSASANKLSN IQKQAKEYAALIMEELDPDNAGFIMIISLSASANKLSNIQKQAKEYAALIMEELDPDNAGFIM( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |