Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G47910_circ_g.2 |
ID in PlantcircBase | ath_circ_042988 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 19399055-19399168 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | AT5G47910 |
Parent gene annotation |
Respiratory burst oxidase homolog protein D |
Parent gene strand | + |
Alternative splicing | AT5G47910_circ_g.1 AT5G47910_circ_g.3 AT5G47910_circ_g.4 |
Support reads | 3 |
Tissues | siliques and seeds |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G47910.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.263883045 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19399130-19399165(+) |
Potential amino acid sequence |
MEELDPDNAGFIMIISLSASANKLSNIQKQAKEYAALIMEELDPDNAGFIMIISLSASANKLSN IQKQAKEYAALIMEELDPDNAGFIMIISLSASANKLSNIQKQAKEYAALIMEELDPDNAGFIM( +) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |