Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G14290_circ_g.3 |
| ID in PlantcircBase | ath_circ_021691 |
| Alias | At_ciR499, Ath_circ_FC1973, AT3G14290_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 4764784-4765466 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, PcircRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT3G14290 |
| Parent gene annotation |
Proteasome subunit alpha type-5-B |
| Parent gene strand | + |
| Alternative splicing | AT3G14290_circ_g.1 AT3G14290_circ_g.2 |
| Support reads | 9/8 |
| Tissues | leaf/root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G14290.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.40976578 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4765181-4765463(+) |
| Potential amino acid sequence |
MEIDDHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQALCDLALRFGEGEEESM LGSTAIGVKTKEGVVLAVEKRITSPLLEPSSVEKIMEIDDHIGCAMSGLIADARTLVEHARVET QNHRFSYGEPMTVESTTQALCDLALRFGEGEEESMLGSTAIGVKTKEGVVLAVEKRITSPLLEP SSVEKIMEIDDHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQALCDLALRFGE GEEESMLGSTAIGVKTKEGVVLAVEKRITSPLLEPSSVEKIMEIDDHIGCAMSGLIADARTLVE HARVETQNHRFSYGEPMTVESTTQALCDLALRFGEGEEESM(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Chen et al., 2017a;Zhang et al., 2019 |