Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0178100_circ_g.10 |
| ID in PlantcircBase | osa_circ_018195 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 4125187-4126110 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0178100 |
| Parent gene annotation |
Similar to Copper-translocating P-type ATPase family protein, ex pressed. (Os03t0178100-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0178100-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.222322655 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4126089-4125318(+) 4125364-4125318(+) 4125386-4125204(+) 4125366-4126077(-) |
| Potential amino acid sequence |
MQQIQKRSGSSKKVEFHSSSGFSKDTELIANAAADPNPTREFMLGDPCLNARRPSKSISLPGPN NAAIAMPHFTYELCNRSKNVPVHQKRLNSIPVQGSARTLN*(+) MLGDPCLNARRPSKSISLPGPNNAAIAMPHFTYELCNRSKNVPVHQKRLNSIPVQGSARTLN*( +) MLEDHQKVYLFQAQTMPLLQCHISHTNYATDPKTFRFIKKG*(+) MNSLVGFGSAAAFAISSVSLLNPELEWNSTFFDEPERFWICCIIRM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |