Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G154000_circ_g.1 |
| ID in PlantcircBase | gra_circ_000276 |
| Alias | Chr03:42279108|42279903 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 42279108-42279903 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G154000 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/9 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.003G154000.4:3 Gorai.003G154000.2:3 Gorai.003G154000.5:2 Gorai.003G154000.7:3 Gorai.003G154000.3:2 Gorai.003G154000.6:3 Gorai.003G154000.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000829 |
| PMCS | 0.954425911 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
42279243-42279870(-) 42279807-42279112(+) |
| Potential amino acid sequence |
MLAYHCLNRNPKARPLMRDIVDSLDPLQLSHPLPIEKTIVTVSTEEYCFPFRGQLE*(-) MTGLSASWRKASPFAAPNAIFILVDHGRGSNTPQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |