Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0155100_circ_g.2 |
ID in PlantcircBase | osa_circ_035896 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 3172660-3173136 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0155100 |
Parent gene annotation |
PapD-like domain containing protein. (Os08t0155100-01) |
Parent gene strand | + |
Alternative splicing | Os08g0155100_circ_g.1 Os08g0155100_circ_g.3 Os08g0155100_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0155100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.227160447 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3172690-3172668(+) 3172685-3172682(-) |
Potential amino acid sequence |
MQLTNKTDHYVAFKVKTTNPKQYCVRPNIGVVLPGSTCDVTVTMQAQREAPPDMQCKDKFLVQS VAAENGATTQDISAEMLNY*(+) MSSASVVQHFCTNILSCCTILSCNTLNKELILALHIRRCLPLCLHRHCNITCRPRQYDANIRAH TVLLWVGCFDLKCNIMVGLIGELHGA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |