Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0450100_circ_g.2 |
| ID in PlantcircBase | osa_circ_024015 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 22430469-22430570 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0450100 |
| Parent gene annotation |
Protein of unknown function DUF341 domain containing protein. (O s04t0450100-01);Similar to H0818E04.16 protein. (Os04t0450100-02 ) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0450100-01:1 Os04t0450100-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.227125245 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22430518-22430483(+) 22430496-22430515(-) 22430537-22430541(-) |
| Potential amino acid sequence |
MWIHSSYVIQRATLFQGLVTLTF*(+) MGFQKVSVTKPWNSVALWMTYDEWIHI*(-) MMNGSTYDSISFSPWVFRKSVSPSLGTVWPFG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |