Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0626600_circ_g.3 |
ID in PlantcircBase | osa_circ_020694 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 23857813-23859983 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0626600 |
Parent gene annotation |
Zinc finger, LIM-type domain containing protein. (Os03t0626600-0 1) |
Parent gene strand | + |
Alternative splicing | Os03g0626600_circ_g.2 Os03g0626600_circ_g.4 Os03g0626600_circ_g.5 Os03g0626600_circ_g.6 Os03g0626600_circ_g.7 Os03g0626600_circ_g.8 |
Support reads | 2 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0626600-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013336 |
PMCS | 0.125017477 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23859606-23857813(+) 23857951-23857818(+) 23857834-23859728(-) |
Potential amino acid sequence |
MSLQFMKVTHTIDPAIRSFSIQNVMSARTLFQQTKMATLNIGPILSGCRSIVLPMKLIVLLGAA VVNEWR*(+) MPPYIFPSTGLRVCAGCKTPIGQGRFLSCMDSVWHPQCFRCFACDRPISEYEFAVHEGNPYHRS CYKELFHPKCDVCKNFIPTNKDGHIEYRAHPFWMQKYCPAHETDRTPRCCSCERMEMR*(+) MINIYLISIRSQLQHLGVRSVSWAGQYFCIQKGWARYSMWPSLFVGIKFLQTSHFGWKSSL*(- ) |
Sponge-miRNAs | osa-miR396c-5p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |