Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0626600_circ_g.3 |
| ID in PlantcircBase | osa_circ_020694 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 23857813-23859983 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0626600 |
| Parent gene annotation |
Zinc finger, LIM-type domain containing protein. (Os03t0626600-0 1) |
| Parent gene strand | + |
| Alternative splicing | Os03g0626600_circ_g.2 Os03g0626600_circ_g.4 Os03g0626600_circ_g.5 Os03g0626600_circ_g.6 Os03g0626600_circ_g.7 Os03g0626600_circ_g.8 |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0626600-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013336 |
| PMCS | 0.125017477 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23859606-23857813(+) 23857951-23857818(+) 23857834-23859728(-) |
| Potential amino acid sequence |
MSLQFMKVTHTIDPAIRSFSIQNVMSARTLFQQTKMATLNIGPILSGCRSIVLPMKLIVLLGAA VVNEWR*(+) MPPYIFPSTGLRVCAGCKTPIGQGRFLSCMDSVWHPQCFRCFACDRPISEYEFAVHEGNPYHRS CYKELFHPKCDVCKNFIPTNKDGHIEYRAHPFWMQKYCPAHETDRTPRCCSCERMEMR*(+) MINIYLISIRSQLQHLGVRSVSWAGQYFCIQKGWARYSMWPSLFVGIKFLQTSHFGWKSSL*(- ) |
| Sponge-miRNAs | osa-miR396c-5p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |