Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0210200_circ_g.1 |
ID in PlantcircBase | osa_circ_010822 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 5759120-5759179 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os12g0210200 |
Parent gene annotation |
Similar to Glutathione S-transferase GST 18 (EC 2.5.1.18). (Os12 t0210200-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0210200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.180556111 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5759178-5759176(+) |
Potential amino acid sequence |
MADVFLAPQIHAGITRFQIDMADVFLAPQIHAGITRFQIDMADVFLAPQIHAGITRFQIDM(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |