Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.013G259100_circ_g.1 |
| ID in PlantcircBase | gra_circ_001471 |
| Alias | Chr13:57436599|57438661 |
| Organism | Gossypium raimondii |
| Position | chrChr13: 57436599-57438661 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.013G259100 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 19/8 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.013G259100.1:5 Gorai.013G259100.2:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000929 |
| PMCS | 0.110153248 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
57436650-57436647(+) 57436615-57438111(-) |
| Potential amino acid sequence |
MDLEPRVQALLEELPKKLTVDILEQLRISKQTLVELCSRAGALRQMLLDLLEDPHEIRRICIMG RNCTLKRGTDDVECSLPLEKLIAEEEEEEIEMLLENYLQRCESCHGQAERLLDSAKEMEDSISV NLRLLKQHYFQEHSVWSRD*(+) MLLQQPQVDRNRIFHFFCRIKKPFCLTMARFTSLKIVLQKHLDLFLLFFSNQLF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |