Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc06g009530.2_circ_g.3 |
| ID in PlantcircBase | sly_circ_001897 |
| Alias | 6:3511784|3512526, Slcirc087 |
| Organism | Solanum lycopersicum |
| Position | chr6: 3511784-3512526 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | Segemehl, CIRI |
| Parent gene | Solyc06g009530.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc06g009530.2_circ_g.2 |
| Support reads | 17/10 |
| Tissues | fruit/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc06g009530.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.897663171 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3512500-3511893(+) 3512342-3512525(-) 3511996-3512488(-) |
| Potential amino acid sequence |
MMLLDNCFLPCISRNKSKFSSRTSPHGKFVDGCTRLINSVRHTSCQ*(+) MNLNIKKGSQHVCVESPGVHELSFPNSCISFGSSSVIIDTSNLSPIYLKGESYLLKGHVHVESS SFSSVEGLPENIPLDILDSEGSVVDGLLARRVPYGVDQSSAAIYEFSMWASPGGKFTFIPRDAR *(-) MSMLNQARLVALRACLRIYRWTFWTVKVLLLMVYWQDVCLTELINRVQPSTNFPCGLVREENLL LFLEMHGKKQLSNSIIRTR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to chilling stress; fruit ripening |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Tan et al., 2017; Yin et al., 2018; Wang et al., 2018b |