Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0469300_circ_g.2 |
| ID in PlantcircBase | osa_circ_014632 |
| Alias | Os_ciR7706 |
| Organism | Oryza sativa |
| Position | chr2: 15867189-15867387 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os02g0469300 |
| Parent gene annotation |
Similar to OSIGBa0148D14.7 protein. (Os02t0469300-01);ATP-bindin g region, ATPase-like domain containing protein. (Os02t0469300-0 2) |
| Parent gene strand | + |
| Alternative splicing | Os02g0469300_circ_g.1 |
| Support reads | 2/3 |
| Tissues | root/pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0469300-02:2 Os02t0469300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.148241248 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15867362-15867330(+) 15867343-15867384(+) |
| Potential amino acid sequence |
MELEWCLWKLSRSFLTTLWTKLRMELLM*(+) MLENKKDGTRMVSVEAFAELLDNSLDEVANGATYVNIDMLENKKDGTRMVSVEAFAELLDNSLD EVANGATYVNIDMLENKKDGTRMVSVEAFAELLDNSLDEVANGATYVNIDMLENKKDGTRMVSV E(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |