Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0469300_circ_g.2 |
ID in PlantcircBase | osa_circ_014632 |
Alias | Os_ciR7706 |
Organism | Oryza sativa |
Position | chr2: 15867189-15867387 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os02g0469300 |
Parent gene annotation |
Similar to OSIGBa0148D14.7 protein. (Os02t0469300-01);ATP-bindin g region, ATPase-like domain containing protein. (Os02t0469300-0 2) |
Parent gene strand | + |
Alternative splicing | Os02g0469300_circ_g.1 |
Support reads | 2/3 |
Tissues | root/pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0469300-02:2 Os02t0469300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.148241248 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15867362-15867330(+) 15867343-15867384(+) |
Potential amino acid sequence |
MELEWCLWKLSRSFLTTLWTKLRMELLM*(+) MLENKKDGTRMVSVEAFAELLDNSLDEVANGATYVNIDMLENKKDGTRMVSVEAFAELLDNSLD EVANGATYVNIDMLENKKDGTRMVSVEAFAELLDNSLDEVANGATYVNIDMLENKKDGTRMVSV E(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |