Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G35340_circ_g.10 |
| ID in PlantcircBase | ath_circ_016581 |
| Alias | At_ciR2611 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 14879013-14879461 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT2G35340 |
| Parent gene annotation |
Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEA H6 |
| Parent gene strand | + |
| Alternative splicing | AT2G35340_circ_g.7 AT2G35340_circ_g.8 AT2G35340_circ_g.9 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G35340.1:3 AT2G35340.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.168610245 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14879255-14879458(+) |
| Potential amino acid sequence |
MRQVTELKPEWLIEIAPHYYQLKDVEDGFFPHTAKLQKNGSYRTVKHPQTVHIHPASGLSQVLP RWVVYHQLVLTSKEYMRQVTELKPEWLIEIAPHYYQLKDVEDGFFPHTAKLQKNGSYRTVKHPQ TVHIHPASGLSQVLPRWVVYHQLVLTSKEYMRQVTELKPEWLIEIAPHYYQLKDVEDGFFPHTA KLQKNGSYRTVKHPQTVHIHPASGLSQVLPRWVVYHQLVLTSKEYMRQVTELKPEWLIEIAPHY YQLKDVED(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |