Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0408100_circ_g.1 |
ID in PlantcircBase | osa_circ_033466 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 12676780-12680183 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0408100 |
Parent gene annotation |
WD40 repeat-like domain containing protein. (Os07t0408100-01);Si milar to predicted protein. (Os07t0408100-02) |
Parent gene strand | - |
Alternative splicing | Os07g0408100_circ_g.2 Os07g0408100_circ_g.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0408100-01:5 Os07t0408100-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.110918077 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12680140-12677110(+) |
Potential amino acid sequence |
MCCVFASNLDCSSSILIDSNDHNNQLHIMYSLETASDQEPHAQRGPVTPSIYSSILHPVVLVHH TEHWPQIQTIWTNCQAEVHPGSAPESRN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |