Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G63880_circ_g.1 |
| ID in PlantcircBase | ath_circ_045615 |
| Alias | Ath_circ_FC3930 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 25564225-25564624 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI-full |
| Parent gene | AT5G63880 |
| Parent gene annotation |
SNF7 family protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G63880.1:2 AT5G63880.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.542472391 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25564589-25564621(+) |
| Potential amino acid sequence |
MDDTADAKAYQDLEKVIEAEKQAARDLIREKRKDRALLALRKKRTQEELLKQVDQWVINVEQQL TDIELTSKQKAVFESLKQGNSAIKAIQSELDLDDVQKLMDDTADAKAYQDLEKVIEAEKQAARD LIREKRKDRALLALRKKRTQEELLKQVDQWVINVEQQLTDIELTSKQKAVFESLKQGNSAIKAI QSELDLDDVQKLMDDTADAKAYQDLEKVIEAEKQAARDLIREKRKDRALLALRKKRTQEELLKQ VDQWVINVEQQLTDIELTSKQKAVFESLKQGNSAIKAIQSELDLDDVQKLMDDTADAKAYQD(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |