Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G01750_circ_g.4 |
ID in PlantcircBase | ath_circ_035932 |
Alias | At_ciR355, Ath_circ_FC3100, AT5G01750_C1 |
Organism | Arabidpsis thaliana |
Position | chr5: 290443-290670 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI-full, circseq_cup, find_circ, CIRI2 |
Parent gene | AT5G01750 |
Parent gene annotation |
Protein LURP-one-related 15 |
Parent gene strand | + |
Alternative splicing | AT5G01750_circ_g.1 AT5G01750_circ_g.2 AT5G01750_circ_g.3 |
Support reads | 11 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G01750.1:1 AT5G01750.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.555431238 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
290443-290667(+) |
Potential amino acid sequence |
MVSMHDRWQVFRGGSTDQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCV VYAGESDAIVAQMVSMHDRWQVFRGGSTDQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDF RVKGSWLERSCVVYAGESDAIVAQMVSMHDRWQVFRGGSTDQRDLLYTVKRSSMLQLKTKLDVF LGHNKDEKRCDFRVKGSWLERSCVVYAGESDAIVAQMVSMHDRWQVFRGGSTDQRDLLYTVKRS SMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCVVYAGESDAIVAQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Ye et al., 2015;Chen et al., 2017a;Zhang et al., 2019 |