Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G61140_circ_g.18 |
ID in PlantcircBase | ath_circ_045134 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 24600987-24601244 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT5G61140 |
Parent gene annotation |
DExH-box ATP-dependent RNA helicase DExH14 |
Parent gene strand | + |
Alternative splicing | AT5G61140_circ_g.7 AT5G61140_circ_g.8 AT5G61140_circ_g.9 AT5G61140_circ_g.10 AT5G61140_circ_g.11 AT5G61140_circ_g.12 AT5G61140_circ_g.13 AT5G61140_circ_g.14 AT5G61140_circ_g.15 AT5G61140_circ_g.16 AT5G61140_circ_g.17 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G61140.1:2 AT5G61140.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.21802258 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24600991-24600989(-) |
Potential amino acid sequence |
MPGRADSLSHEDHLDGYYPRDTELYLTVFYCNFPHCAAQEVHHTQKHQPRYAKMPGRADSLSHE DHLDGYYPRDTELYLTVFYCNFPHCAAQEVHHTQKHQPRYAKMPGRADSLSHEDHLDGYYPRDT ELYLTVFYCNFPHCAAQEVHHTQKHQPRYAKM(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |