Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G61140_circ_g.18 |
| ID in PlantcircBase | ath_circ_045134 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 24600987-24601244 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT5G61140 |
| Parent gene annotation |
DExH-box ATP-dependent RNA helicase DExH14 |
| Parent gene strand | + |
| Alternative splicing | AT5G61140_circ_g.7 AT5G61140_circ_g.8 AT5G61140_circ_g.9 AT5G61140_circ_g.10 AT5G61140_circ_g.11 AT5G61140_circ_g.12 AT5G61140_circ_g.13 AT5G61140_circ_g.14 AT5G61140_circ_g.15 AT5G61140_circ_g.16 AT5G61140_circ_g.17 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G61140.1:2 AT5G61140.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.21802258 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24600991-24600989(-) |
| Potential amino acid sequence |
MPGRADSLSHEDHLDGYYPRDTELYLTVFYCNFPHCAAQEVHHTQKHQPRYAKMPGRADSLSHE DHLDGYYPRDTELYLTVFYCNFPHCAAQEVHHTQKHQPRYAKMPGRADSLSHEDHLDGYYPRDT ELYLTVFYCNFPHCAAQEVHHTQKHQPRYAKM(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |