Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G09200_circ_g.1 |
| ID in PlantcircBase | ath_circ_030044 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 5861014-5861228 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT4G09200 |
| Parent gene annotation |
At4g09200 |
| Parent gene strand | + |
| Alternative splicing | 4_circ_igg.2 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 4_circ_ag.6 4_circ_ag.7 4_circ_ag.8 4_circ_ag.9 4_circ_ag.10 4_circ_ag.2 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 4_circ_ag.6 4_circ_ag.7 4_circ_ag.8 4_circ_ag.9 4_circ_ag.10 4_circ_ag.11 4_circ_ag.12 4_circ_ag.13 4_circ_ag.14 4_circ_ag.15 4_circ_ag.16 4_circ_ag.17 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G09200.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.116666395 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5861020-5861225(+) |
| Potential amino acid sequence |
MTAEIDDAIAALKDRYPQLIEGGSEAYFLLICQKIVELVRLIMTAEIDDAIAALKDRYPQLIEG GSEAYFLLICQKIVELVRLIMTAEIDDAIAALKDRYPQLIEGGSEAYFLLICQKIVELVRLIMT AEIDDAIAALKDRYPQLIEGGSEAYFLLICQKIVELVR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |