Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G09200_circ_g.1 |
ID in PlantcircBase | ath_circ_030044 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 5861014-5861228 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G09200 |
Parent gene annotation |
At4g09200 |
Parent gene strand | + |
Alternative splicing | 4_circ_igg.2 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 4_circ_ag.6 4_circ_ag.7 4_circ_ag.8 4_circ_ag.9 4_circ_ag.10 4_circ_ag.2 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 4_circ_ag.6 4_circ_ag.7 4_circ_ag.8 4_circ_ag.9 4_circ_ag.10 4_circ_ag.11 4_circ_ag.12 4_circ_ag.13 4_circ_ag.14 4_circ_ag.15 4_circ_ag.16 4_circ_ag.17 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G09200.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.116666395 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5861020-5861225(+) |
Potential amino acid sequence |
MTAEIDDAIAALKDRYPQLIEGGSEAYFLLICQKIVELVRLIMTAEIDDAIAALKDRYPQLIEG GSEAYFLLICQKIVELVRLIMTAEIDDAIAALKDRYPQLIEGGSEAYFLLICQKIVELVRLIMT AEIDDAIAALKDRYPQLIEGGSEAYFLLICQKIVELVR(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |