Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0640750_circ_g.1 |
| ID in PlantcircBase | osa_circ_025560 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 32591763-32592143 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ie-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0640750 |
| Parent gene annotation |
Hypothetical protein. (Os04t0640750-00) |
| Parent gene strand | + |
| Alternative splicing | Os04g0640750_circ_g.2 Os04g0640750_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0640700-02:1 Os04t0640700-01:2 Os04t0640750-00:1 Os04t0640700-02:1 Os04t0640700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014919 |
| PMCS | 0.30346343 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32592067-32591833(-) |
| Potential amino acid sequence |
MCSYNKVNGKPTCADKDLLSGVIRGDWKLNGYIVSDCDSVDVLYNNQHYTKNPEDAAAITIKSG VPAGSGRHVPAPVQELRDRRQCGQCYVLLQQGQWEAYLCRQGPLVRSHQRGLEAERIHCVGLRF G*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |