Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0567366_circ_g.3 |
| ID in PlantcircBase | osa_circ_040233 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 22649903-22651504 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0567366 |
| Parent gene annotation |
Similar to Aldo-keto reductase/ oxidoreductase. (Os09t0567366-01 );Similar to Aldo-keto reductase/ oxidoreductase. (Os09t0567366- 02);Similar to Aldo-keto reductase/ oxidoreductase. (Os09t056736 6-03) |
| Parent gene strand | + |
| Alternative splicing | Os09g0567366_circ_g.1 Os09g0567366_circ_g.2 Os09g0567366_circ_g.4 Os09g0567366_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0567366-02:6 Os09t0567366-01:7 Os09t0567366-03:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.161969715 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22650113-22650082(+) 22649938-22651469(-) |
| Potential amino acid sequence |
MTRSYVEDNINRSRKRMDVSALDMLQFHWWDYANPGYLDALKHITDLKEEGKIKTVALTNFDTD RLQIILENGIPIVSNQVQHSIVDMRPQRRMAELCQLTGVKLITYGTVMGGLLSEKFLDTNVSIP FAGPPLNTPSLQKYKRMVDAWGGWSLFQALLQTLKKVSLKHGVSISTVAVRYILNQMDQQRICM AFSSIEFGVSGHLSCLKKSRG*(+) MKRPYKSSAGPSGSVCISQQQLI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |