Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G007400_circ_g.1 |
| ID in PlantcircBase | gra_circ_000554 |
| Alias | Chr06:1543844|1544511 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 1543844-1544511 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G007400 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 19/35 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.006G007400.6:2 Gorai.006G007400.3:2 Gorai.006G007400.5:2 Gorai.006G007400.4:2 Gorai.006G007400.1:2 Gorai.006G007400.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000282 |
| PMCS | 1.159474513 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1543864-1544405(-) 1544400-1543920(+) |
| Potential amino acid sequence |
MEGEVQSWKYYLLLGTRRGWTIRPWGCGGSTFSDSIECFRWT*(-) MSCPSKALNRVGESRSSASPWPNCPSSPRPQEQIIFPALHLAFHCHSQTMAVTTSNLFDPQTM* (+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |