Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G041500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000239 |
| Alias | Chr03:5033499|5033872 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 5033499-5033872 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G041500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3/7 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.003G041500.3:1 Gorai.003G041500.2:1 Gorai.003G041500.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.16705 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5033582-5033871(-) 5033823-5033818(-) 5033847-5033538(+) |
| Potential amino acid sequence |
MAFLKPVMKLLRPIMKPYNMTMKLFSKR*(-) MLDGLDEEGCLEESGHVAEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVW FQNRRARWKTKQLERDYGLLKTSYETLKANYEALQHDNEALLKEMNIVLGTTMFTAGSFSRC*( -) MVVPRTMFISLRRASLSCCKAS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |