Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0374100_circ_g.1 |
| ID in PlantcircBase | osa_circ_036872 |
| Alias | Os_ciR1891 |
| Organism | Oryza sativa |
| Position | chr8: 17513904-17514896 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os08g0374100 |
| Parent gene annotation |
Similar to Ubiquitin carrier protein. (Os08t0374100-01);Similar to Ubiquitin carrier protein. (Os08t0374100-02) |
| Parent gene strand | - |
| Alternative splicing | Os08g0374100_circ_g.2 |
| Support reads | 6/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0374100-01:3 Os08t0374100-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.345454607 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17514013-17514012(+) 17514833-17514833(-) |
| Potential amino acid sequence |
MIDLSLALDFGWFMRIGRRNLESKNKFTTYIVSLIRSNSNFKVHQIILAIRKRNSSRLRKVKFS NIEKRRFKPYTIVLTFRTGFQSSRRMLRQTFPSKSILG*(+) MNFEVTIRPDEGYYVGGKFIFTFQVPPAYPHEPPKVKCKTKVYHPNIDLEGNVCLNILREDWKP VLNVNTIVYGLNLLFSILLNLTFLSRLEFLFLMARMI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |