Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0561900_circ_g.2 |
| ID in PlantcircBase | osa_circ_008013 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 22163091-22164067 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0561900 |
| Parent gene annotation |
Protein-tyrosine phosphatase, dual specificity domain containing protein. (Os10t0561900-01);Protein-tyrosine phosphatase, dual s pecificity domain containing protein. (Os10t0561900-02);Similar to Protein-tyrosine phosphatase mitochondrial 1. (Os10t0561900-0 3);Similar to Protein-tyrosine phosphatase mitochondrial 1. (Os1 0t0561900-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0561900-02:2 Os10t0561900-04:2 Os10t0561900-01:2 Os10t0561900-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.220187709 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22163987-22163984(-) |
| Potential amino acid sequence |
MNPTRGWFPGACMRLMELKTWCYQLEIIFMHHHLRTFAGLLTSSTHVLLGAVPFPSDVLRLKEL GVCGVVTLNESYERLVPRCLYEAHGIENLVLPTRDYLYAPSFENLCRAADFIHTCSARCCSFPQ RCSTAEGAWSLRCCDTE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |