Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0563250_circ_g.10 |
| ID in PlantcircBase | osa_circ_031182 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 21657869-21658303 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0563250 |
| Parent gene annotation |
Hypothetical gene. (Os06t0563250-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0563250_circ_g.1 Os06g0563250_circ_g.2 Os06g0563250_circ_g.3 Os06g0563250_circ_g.4 Os06g0563250_circ_g.5 Os06g0563250_circ_g.6 Os06g0563250_circ_g.7 Os06g0563250_circ_g.8 Os06g0563250_circ_g.9 Os06g0563250_circ_g.11 Os06g0563250_circ_g.12 Os06g0563250_circ_g.13 Os06g0563300_circ_g.1 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0563250-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.219349061 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21657903-21657884(+) 21658259-21657942(+) 21658025-21658290(-) |
| Potential amino acid sequence |
MNLDSRSVGTGTSSSASTSSSRGLLPNGGCSDKSSFLNSDILFPPGGYPSLRLPVVVASQDVNL VARCRRVYAHAHDYHINSISTNRCKRRK*(+) MHMLMITILTLYQPIGAREESKTSFSYEFGFTECRDWYLF*(+) MSLFKKLDLSEHPPFGRRPLELLVLALEEVPVPTLRESKFITETCFTFFSCTYWLI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |