Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d014037_circ_g.1 |
| ID in PlantcircBase | zma_circ_008435 |
| Alias | zma_circ_0002058 |
| Organism | Zea mays |
| Position | chr5: 30101829-30107301 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d014037 |
| Parent gene annotation |
Serine/threonine protein phosphatase 2A regulatory subunit B''al pha |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d014037_T011:6 Zm00001d014037_T004:6 Zm00001d014037_T013:6 Zm00001d014037_T008:6 Zm00001d014037_T009:6 Zm00001d014037_T017:3 Zm00001d014037_T003:6 Zm00001d014037_T015:6 Zm00001d014037_T007:5 Zm00001d014037_T012:6 Zm00001d014037_T002:6 Zm00001d014037_T014:5 Zm00001d014037_T010:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.069054358 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30107204-30107300(-) |
| Potential amino acid sequence |
MFPAGSAPPLSPRSTSGSPRVMRRGSGAGPSSLGSPLKLVSEPVREVIPQFYFKNGRPPTKDLK EQCLSRTDHLFFGGEGLQIQEFRSVTKDICRLPSFFSSALFKKIDVACTGTVSRDAFVEYWMDD NKITMDMASQIFEILRKPGCTYLTQDDFKPVLKELLATHPGLEFLQGTPEFQERYAETVIYRIF YSINRSGNGHLTLRELKRGNLIAALQQLDEEEDINKVLR*(-) |
| Sponge-miRNAs | zma-miR169l-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |