Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0125600_circ_g.1 |
| ID in PlantcircBase | osa_circ_006144 |
| Alias | Os10circ00663 |
| Organism | Oryza sativa |
| Position | chr10: 1644020-1644566 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
| Parent gene | Os10g0125600 |
| Parent gene annotation |
Hypothetical gene. (Os10t0125600-01);Hypothetical protein. (Os10 t0125600-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3/3 |
| Tissues | leaf and panicle/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0125700-00:1 Os10t0125600-02:3 Os10t0125600-01:3 Os10t0125700-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.108013406 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1644414-1644060(+) 1644207-1644536(-) |
| Potential amino acid sequence |
MFIGEYDERFSEAFKEILQDVKHVRVLRLFQTTLEFLPSKLIHLRYLRIQASVVGTWCYKLQWS G*(+) MKQTMHDIPYILDSIILTTAVYNTKCRPQMLGFLSNEGG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |