Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa3G307690_circ_g.1 |
| ID in PlantcircBase | csa_circ_001758 |
| Alias | Chr3:17386763_17387735 |
| Organism | Cucumis sativus |
| Position | chrChr3: 17386763-17387735 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Csa3G307690 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Csa3G307690.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.124708291 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17387695-17387730(-) |
| Potential amino acid sequence |
MNSFNTHDDTQKIIEKYKGSNVDIHTFNQSQYPRLVVDDYLPLPSKGRTDKDGWYPPGHGDVFP SLKNSGKLDALIAQGKEYVFVANSDNLGAVVDLQS* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to salt stress in root |
| Other Information | |
|---|---|
| References | Zhu et al., 2019 |