Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa3G098540_circ_g.1 |
| ID in PlantcircBase | csa_circ_001412 |
| Alias | Chr3:4855342_4855572 |
| Organism | Cucumis sativus |
| Position | chrChr3: 4855342-4855572 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | Find_circ |
| Parent gene | Csa3G098540 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Csa3G098540.1:1 Csa3G098540.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.284629293 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4855400-4855569(+) |
| Potential amino acid sequence |
MHVKIGDTVKVIAGRDKGKIGEITKIFKHNSKVVVNEINLKTKHVKSREEEEQGQIIKLKRWER KECKPNSLPVVHKMHVKIGDTVKVIAGRDKGKIGEITKIFKHNSKVVVNEINLKTKHVKSREEE EQGQIIKLKRWERKECKPNSLPVVHKMHVKIGDTVKVIAGRDKGKIGEITKIFKHNSKVVVNEI NLKTKHVKSREEEEQGQIIKLKRWERKECKPNSLPVVHKMHVKIGDTVKVIAGRDKGKIGEITK IFKHNSKVVVNEINLKTKHVKSREEEEQGQIIK |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | He et al., 2020 |