Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0136600_circ_g.1 |
| ID in PlantcircBase | osa_circ_029576 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 1934053-1935429 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0136600 |
| Parent gene annotation |
Similar to Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate dehydrata se 1) (2-phospho- D-glycerate hydro-lyase 1). (Os06t0136600-01); Similar to Enolase. (Os06t0136600-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0136600-02:7 Os06t0136600-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.176782123 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1934110-1935422(-) 1934784-1935408(-) |
| Potential amino acid sequence |
MAKMPQMWGMKVALLLTFRNI*(-) MVQQLDGTSNNWGWCKQKLGANAILAVSLAVCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFN VINGGSHAGNKLAMQEFMILPTGASSFKEAMKMGVEVYHHLKSIIKKKYGQDATNVGDEGGFAP NIQEYMRPWS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |