Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d022046_circ_g.1 |
ID in PlantcircBase | zma_circ_009467 |
Alias | zma_circ_0002644, GRMZM2G313553_C1 |
Organism | Zea mays |
Position | chr7: 168706302-168708287 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d022046 |
Parent gene annotation |
SNF2 domain-containing protein / helicase domain-containing prot ein / HNH endonuclease domain-containing protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d022046_T002:4 Zm00001d022046_T005:3 Zm00001d022046_T007:4 Zm00001d022046_T012:4 Zm00001d022046_T006:3 Zm00001d022046_T016:4 Zm00001d022046_T024:4 Zm00001d022046_T022:4 Zm00001d022046_T017:4 Zm00001d022046_T001:4 Zm00001d022046_T020:4 Zm00001d022046_T013:4 Zm00001d022046_T003:3 Zm00001d022046_T004:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.130963611 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
168708230-168706323(+) 168706371-168706331(+) |
Potential amino acid sequence |
MRKNIACCMLHEVIRGKCLSIWSSRQS*(+) MLSRLRESMVNRTWALMIVDESHNIRCTKKLEEKYELALTIYFLLGDNRPFDIYHQINMLWPHM LGTDKFDYAKKYCLLHVARSYQGKMFKYLVVKTVLNI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |