Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0433600_circ_g.3 |
ID in PlantcircBase | osa_circ_014537 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 13765569-13766316 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0433600 |
Parent gene annotation |
Helix-loop-helix DNA-binding domain containing protein. (Os02t04 33600-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0433600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_003882* |
PMCS | 0.260111575 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13765623-13765625(+) |
Potential amino acid sequence |
MLKDLTSQVNKLKAEYTSLSEEARELTQEKNELRDEKVSLKFEVDNLNTQYQQRMRVLYPWTGM EPSVVIGPPLPYPFSVPVPVPVPIPSGAVPMHPQLQAYPYFRNQTSGTVSNPCTPYMAYTQPIH PPTDQLSNQFSAPVQHSSSNRSHSMAQDSRSKSSALQQVSCRGKHDDFDDVATDLELKTPGSSA PLQSEIANKIQIDPGMIRQLSLVMQFKC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |