Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d011963_circ_g.4 |
| ID in PlantcircBase | zma_circ_009779 |
| Alias | zma_circ_0002894 |
| Organism | Zea mays |
| Position | chr8: 165267263-165269678 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d011963 |
| Parent gene annotation |
ATP-dependent RNA helicase DHX8 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d011963_circ_g.1 Zm00001d011963_circ_g.2 Zm00001d011963_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d011963_T002:4 Zm00001d011963_T003:4 Zm00001d011963_T001:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.135508885 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
165268017-165267274(+) |
| Potential amino acid sequence |
MTDGLLLREALLDPLLSKYSVIVVDEAHERTVHTDVLLGLLKKVQHSRANTNKNGKTLLGHSQN VTIKECQGIRCAPLKLIIMSASLDAKCFSDYFGGAKAVHIQGRQYPVDILYTYQPESDYMDATL VTIFQIHLEEGPGDILAFLTGQEEIESLERLIHERARLFPPESSKICVTPIYSSLPSEQQMNAF KPAPAGTRKWRKG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |