Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0177000_circ_g.3 |
| ID in PlantcircBase | osa_circ_018175 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 4083622-4084366 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0177000 |
| Parent gene annotation |
Acyl-CoA N-acyltransferase domain containing protein. (Os03t0177 000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0177000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.130582148 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4084331-4083647(+) 4084350-4083647(+) 4083636-4084313(-) |
| Potential amino acid sequence |
MLLLAIDAARLNGISCIKEAM*(+) MLQDSMEFHALKRRCSKLQGEKYICFVAVKNDDLKRTVLNSVVGTLDVCIRHPLHGETFPAEPG KSSFHCRIYQPDQPKFGYLTNVCVAKYARRQGIASNMLLLAIDAARLNGISCIKEAM*(+) MHEIPLSLAASMASNNILLAIP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |