Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G40540_circ_g.8 |
| ID in PlantcircBase | ath_circ_017650 |
| Alias | Ath_circ_FC1606 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 16933067-16933321 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT2G40540 |
| Parent gene annotation |
Potassium transporter |
| Parent gene strand | + |
| Alternative splicing | AT2G40540_circ_g.2 AT2G40540_circ_g.3 AT2G40540_circ_g.4 AT2G40540_circ_g.5 AT2G40540_circ_g.6 AT2G40540_circ_g.7 |
| Support reads | 15 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G40540.1:1 AT2G40540.3:1 AT2G40540.4:1 AT2G40540.5:1 AT2G40540.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.80396516 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16933216-16933318(+) |
| Potential amino acid sequence |
MHGQIYIPEINWMLMILCIAVTIGFRDVKHLGNASECLHWPVLAVAILASVVGSQAIISGTFSI INQSQSLGCFPRVKVIHTSDKMHGQIYIPEINWMLMILCIAVTIGFRDVKHLGNASECLHWPVL AVAILASVVGSQAIISGTFSIINQSQSLGCFPRVKVIHTSDKMHGQIYIPEINWMLMILCIAVT IGFRDVKHLGNASECLHWPVLAVAILASVVGSQAIISGTFSIINQSQSLGCFPRVKVIHTSDKM HGQIYIPEINWMLMILCIAVTIGFRDVKHLGNAS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |