Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G40540_circ_g.8 |
ID in PlantcircBase | ath_circ_017650 |
Alias | Ath_circ_FC1606 |
Organism | Arabidpsis thaliana |
Position | chr2: 16933067-16933321 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | AT2G40540 |
Parent gene annotation |
Potassium transporter |
Parent gene strand | + |
Alternative splicing | AT2G40540_circ_g.2 AT2G40540_circ_g.3 AT2G40540_circ_g.4 AT2G40540_circ_g.5 AT2G40540_circ_g.6 AT2G40540_circ_g.7 |
Support reads | 15 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G40540.1:1 AT2G40540.3:1 AT2G40540.4:1 AT2G40540.5:1 AT2G40540.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.80396516 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16933216-16933318(+) |
Potential amino acid sequence |
MHGQIYIPEINWMLMILCIAVTIGFRDVKHLGNASECLHWPVLAVAILASVVGSQAIISGTFSI INQSQSLGCFPRVKVIHTSDKMHGQIYIPEINWMLMILCIAVTIGFRDVKHLGNASECLHWPVL AVAILASVVGSQAIISGTFSIINQSQSLGCFPRVKVIHTSDKMHGQIYIPEINWMLMILCIAVT IGFRDVKHLGNASECLHWPVLAVAILASVVGSQAIISGTFSIINQSQSLGCFPRVKVIHTSDKM HGQIYIPEINWMLMILCIAVTIGFRDVKHLGNAS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |